GenomeNet

>rs:NP_249675 [NP_249675] colicin immunity protein [Pseudomonas aeruginosa PAO1].
msfkyywakffwgafffvlvawkgsvfpslasvnplvvaglstilfpfsvklvedfalky
terefwvtgffsetpaktglyavfylscylfsiplgmvflfykygkas

BLAST