GenomeNet

>rs:NP_620530 [NP_620530] minor core protein [Rice dwarf virus].
msaivglcllsekvvlsrsltdevsklyklnrgnvkeprkyatermstqskpvalqvpvs
tiildykdedfikqnptysamdiigspsntapqtafqsimpslsalfntpfiqgafrhrv
issmgpeisylvmvigppsgfmdtpmyrtvnhlsilmsnadvdlidiiainstmakstkl
vfastfqamlvndvydrcmvlvgiflsqalpffrnyvnvqskgslppavaaclntpikel
fsmgsgkreplalefrkdnegqclgivlpkghegdtlssrypavfinesepfsdeersel
sklkrtdpdayeklysetiskhvsdgsygnrviishkmsrlsnggvkiigrfkisdfntv
kknlssrpgevdsakeqwealsgnglvtdnntsmlhdkildtitsnkpgvvlrdgnkksd
nivvcfkngfpnkkhsllqltkngisvvsldeltdagilvestgpdrvrrspkalankls
sfkgrkvtldvdnmstealiqklstl

BLAST