GenomeNet

>rs:WP_002726193 [WP_002726193] hypothetical protein [Magnetospirillum molischianum].
msdfasfmdgspdaktedpnsfgsfmasvesdrsarlgsnliaaadtnpdahakameigr
qigapadaiaanlgegermaklqkmrealgsapklaefltsdpdmaklssddfsaltrle
gsmtaaasfgrgvdllqsmlygaaewsgeatgskdlatwarrgrqaneaeaaahgtrsqf
lniggvgdaaqwgketlfeqlplmspalagslagagiggavggppgavaggliggfapsv
vmgigetqgqlkqkdpnaeapvsvavggiaiglldsivpgligrrlvtvlgkeaaekvth
egiaaaagallkgagiegateaaqeaigefaaahgadqavdwqglgpqmveaaaagflmg
gafeggakgieklaerqkvaeakktaaaltdavaatqesklatrdperfadlvrqiagdg
qlhipaeslqslyqsgviddatldgldvtaqlpealaaggdvlvdpakylsaaskltpea
laqmigstrrgatdmtmkeveafladparrkdatdlieslsiqyegakpgqivedevtqa
lmktghytesqakaqavlwrermiqrgadrgmdpdalwleekprilgpaprlpvddidlv
lerirsgnevkpprqpvldifrhlggvkpgsmlaqelaamgitpkeapglfrptgigsad
qvvvsehevlrdnqvkadnsgngyadhdalmqavarewagdplqtqayrdraarldapvr
dlrkaleaegiipelatkenvlrlmerdqsadalgqeagrvisalqeivagadeatvsdl
rpdlvslggasdvsfvwgnskrglehigrkrgasvvlqviravalgkitkqvegkktvhl
eldgteavlsldlngdrktwlltgweigkpdargevgaqskatqnaptfsrddlgaglqa
iisrgdplfqpnggglrgsfdpiddtirlfetanlstflhegghlwlfqmvrdlgderlr
peardrtvrdlqtvmdwmnveidvataspgdiqaaipveahekwargieaylmegkapsv
alrdvfqrfsawlirtykkvrnlsvkltpeirgvmdrllasdeaieqarrdsvfrvpsel
lavlalaerreieqaqeqaaleakaelqgramrelarerlawwkteregvraeveadvrt
rpayrvvalskgigpdgaklidpdtgeaqvlkldrkalvaeygeeivrllptgvtvakgg
vnhhivagwfglphgdalrlalmdakanpqaevieretdarmrerhgdmvtdgriaedaa
divatgkaieavalqakclkrlvgdtidkaaarrqaeqgagsrsddqaridaaatstdqv
inagvpaegttaaqvaeamaageakaaplqrtaqraavrqvrnilagmdhtaireaaakf
iaarqvsqatdatmyraqakrhekratlalaardyveahdakqqqllnmelerlareart
evekfqakarrlnkpdgklaatmdedffraarqvlaryglaransdfdtkvwldrleetd
pagaediaaiianltkaptpgqvksrimpdgrrveiapdyrdmtmaafrdlrdgvqallt
mgrnarsalvdgerveferiteearaqlepfqrdrdlshmptdteknrhgllgivaswri
aeswarladlgkvgvmtkyvirpvfdavhayrtarreiqekllailspvrddlakpqliq
apelkdgfyfsnkgqlihailhtgnesnmkkllvgwkwatlnkdgsfdrsgwasfmsrmf
adgvvtkadmdmvqsvwdllestkpaaqaahkamygvgfkeieaspiktpfgeyrggyvp
altekslnvdgagqeavealtaqqsgamfpaaargftenrvenyaepltldllllpahln
kvllfshvgpavrqtarllkrrdfrevvgrydpsaidgvlwpmleravrqtvetpaltpg
grkaaefaryfrttaglqamcgnllnaaqqitgissaatmvgggalarslvtvwrnpess
taaimaksalmrermdssayeasmeiekilkdhtllgkgqsfaqrhgyfaqqlaqnfvdr
vvwwaaydkeigngtaeaeavqqadsavrltqgsfspesvaaveagnawvrlftqfmtyf
maqgnmiatevmialrtmtggnlsrrlagvyvfaflipavvaeaimqagrgelgdedddg
wlddlaslfllpqlrffaamipvagpvamlginalndkpyddrlaaspavtlmesagraa
vttakavagdgdksravsdamnavsvatgiptgmirkpasyavdvaegdsrprhlgnvvs
giltgqdgtar

BLAST