GenomeNet

>rs:WP_011171394 [WP_011171394] DUF2109 domain-containing protein [Methanococcus maripaludis].
meslvtvtigligiisvikvfltksralklpiiccinfciaalialyikspmgavaavvy
falstvssnaiahtlgeidkmdefekkr

BLAST