GenomeNet

>rs:WP_011220668 [WP_011220668] hypothetical protein [Photobacterium profundum].
msdfgvwmeenqgntnineldtpkevtdldnflqngeqqqnfqlstsmkygreadperag
rvfrqqlktglpseliernlddiekqsaekdfdpvafrnkspllsgwlqkpenakvshdd
lenlstmewlfrapveayqdgadqvrlgglrykqmtsqlndnelqfidaykkrgprsyga
dswigeafvgatgqlsqfapmieeglkygvpagltagtfalaagqagpqialpeeiftvp
gatalglssgfaygkakqsfelqtglaydefkdfkdinghpldddvakgaaffagafnag
ldfvaldklietipgaknimsggatavikqalknptvteglkrfsteygksvsaqvmida
gqelvqmiagetakryqgnfensdmvaigdrmvealdaslkanvvlsapghsmtltgdll
ksrqaqqnkqimqqlgnstqqsklharapekvrelmatvkengpvqdvmipveqwntlfq
sesvdplsmaaeilgddgmqyreaaatgsdimipldvyteklagsqyhnmllddmrfepd
qmtareaaawdasnqqnieqqaasiadfitqpdetqfifddivgqlkntgmemgtaetna
iqmqsffrtlssrtgidakklwsqygpkvtrempevlksaggnfdiavdpildrirandi
pelsdiqgktmletlrekgiqdvggelsardvdvklkpfqkklisesgvtlddaaqlmae
agyipadidsvtqndlleaidremagdpvysqlnenakaledretllsmsgyledlgidv
sqvsnqdikqqlsnqianegdgvtlnqaergeikisqdkkfqitffknadlstllhesgh
myfeilqdidkkgmasesisndlktvrdwvgakdgkditteqheqfargfeqylregkap
ttelqsafarfrawlvtiyrqasklnvdvsedvrqvfdrmlatddqikaaetqmeynrlf
edaesagmteaefnryqkdatlareqaqeevtvkafnemqreqkkwwkdaeidmrdqvma
emaenptyqavnylqkgklldmdlpegvealklsknalvekygkqflkllprpyiytktg
gahpdqiavlfgfssgdemmqlivnarpmkdvvnaevdtrmrqqygdmmndgtlpetamd
aahndrrasvlaaelkalsrrvssrgaptpaammkqaaqtvvdrktvrslkpsvylnaer
kaakqaleavlagdyaaaadakqrqllnfymgnytkkakaetdksrdylnsfnrpkkrqa
lgkaghdyldqidallektefkrvslisldrrkslsefiqnqeeqgwtveipeslvkqtq
srnwkdmtveeltglrdavknidylarfknkllrqdekrkfeeivdaavssieannvvhe
ikpnfaetwkdrvkenvsgfmashtkmefffewldgdsangeawrsfykpindadnkekl
mqesytkrlagildaytskergkwytdtshiqhvgrvnkamamsvalnwgnvgnqqavld
gytrndgknwteteaqrilemldqkdwdtiqkvwdlindlwpeisklqkdltgvspekve
asliqtkygeikggyyplvydqklsyavfkrdekaatqdlfesnfskpatkkghtiertg
sggqavkldlsvisehidnvihdithrralmdtdrliqnprvraaiektagrqmyrqlrp
wlqsiareqqptfnyvetligkartgatvvnmglkvttaiaqplgvlnsvdelgvismmk
gikdfyanspvgmkkrldfvtsrsammrnrqktfdrdikdaakrlgkdkkfdkvresffy
ltglldmgvsvptwlaayrkaldgnvdgitagdentaidfadrtvrvtqseggakdlaki
qrggevfrsftmfysyfsvlhnqlrkrgrqyvrgdtntsqlaasmfflwfapavlgelva
grgpgddedwdkwalkeissypfqtvvfvrdlvnglgdfgysaspafdafemsvkavklp
ykaiapdeevkrsdvkaavlaagywgqlpsrqawitgeyvydmmtgeekpedgfemmrnl
mltrprd

BLAST