GenomeNet

>rs:WP_012697027 [WP_012697027] hypothetical protein [Laribacter hongkongensis].
mnrldnylntlnqqrndqlagslrdalqvnpddyaktvrlakaagveveavplyadvaqe
aqylegigfrslwkdspktaeflsdarnarlahddvanlsvleklarsagagltaanagl
wgmaqagtellvkpvtgalaglgvlpedvggrmgrvvfpdapdpg

BLAST