GenomeNet

>rs:WP_012907116 [WP_012907116] T3SS structural protein SepQ [Citrobacter rodentium].
mkplnsqsnmkindfylpllpvigigrlyitseghachayfrevsgngfrftlaysgyeg
cfwvseeqliqwchelfpysdsrlipedtiklmllwaihatlpeddasvddvqfttlnkd
iypviennngknrlnviilettvqslqylindnwqlvphsntlffdgyiapgwtdypitk
lsigdslrlyhvddsqerkcwlvinnplatvklsdnnlsvtdvqaadplciisnetvmnr
iycaigtinvdihklrnlkkddtigsvgyhlfgggrlirnntiiaygtiikinedfyfni
svvcd

BLAST