GenomeNet

>rs:WP_013799737 [WP_013799737] DUF2109 domain-containing protein [Methanotorris igneus].
mdlssiiigviavicglrvfltqsrarkllylcclnfciaalialyikspmgslaaivyl
isstlssnaiaytleqmkkme

BLAST