GenomeNet

>rs:WP_069584690 [WP_069584690] MULTISPECIES: DUF2109 family protein [Methanobacterium].
mlieiagiiivfmalrtliardrsermlylnamsfgisalialyiqtpfgaiiaityfva
stissnaiaysigriqeeitvk

BLAST