GenomeNet

>tr:A0A059F4T5_9MICR [A0A059F4T5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KCZ82210.1};
MQLQQQQQKTKNKEHTQDEIDLEIQEHIKKVEQENFDIVVHQREKLKEAHKKQKQTTQDL
LKQGEQLSNISKTAGRIYKKSKEGEKTTEDIKREGRFFKFPKIFTKIKEIFKPKDKVLEN
INKKKEKKSEYKPSELDSKTGATTDDNLKLLLGDLRQMRKEAEFQNKEINKQKVDINHIS
KVSKESEHIMSKTTQELRKI

BLAST