GenomeNet

>tr:A0A066YTY5_9ACTN [A0A066YTY5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KDN83454.1};
MATPDELEPLIALTPPAAEQAWDTAEYTCARCWTTVTASTEAEFVRLVVEHRDSCRGPQA
GAR

BLAST