GenomeNet

>tr:A0A089L237_9BACL [A0A089L237] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AIQ55536.1};
MSDQSATIKELALLYKSLHRSFPYQDSARLKEDFAAAFTHLKEESFNADLSEYCALIAGT
ISYVIHNSVTEIPQRQLALLRKSFFERYPAYAFIQPGLSEYPTISADLEAHERARGMLLR
IIKENKNL

BLAST