GenomeNet

>tr:A0A090E0C4_9BACT [A0A090E0C4] SubName: Full=Conserved putative membrane protein {ECO:0000313|EMBL:CDR34264.1};
MTPKFKLTRQSVTISALLVYSAPLIFVLGFSKNQTFSSWTIFSIALLILSAASLIHLSLL
FNFYKNEGEGFEGSSEKENPDQKEAFLSEERRVELEELENLRAKEEELREEISYRNEELL
RLTREKEFEISLREQLEDDFDRFRKDSEDRLAEEKILLQEYAENISSLRASLEERQEENE
RLQSKIRDMAYEIKTLVDLADVESEIKEFKEPEVRAVPFKEMEPHGQFKMTFPDFRNEEE
AACSFKSQVRTEDEAKKLLKRCLDIAQKITVSHHFTNEKSRFRDLPFDNHGLDLRRLCDS
LRSETTGAVLVYSQKENRILFINNQIRALLGFGPDKFVQDFENIVQGGLNEWKSAIAKMN
TLYEAEASLVMKNKAGQDVLLRCQLGLIPTGVFRNSAIGVFYNS

BLAST