GenomeNet

>tr:A0A0C1JYI3_9BACT [A0A0C1JYI3] RecName: Full=PAS domain-containing protein {ECO:0000259|PROSITE:PS50112};
MPVQKGWNLLAFGIFCSSIGLLGIFWMMCRLSHKAEHGTRDNQPSVLEASEFSPKQSNIV
ELDMTQAKALEDLQEQYNELHAQVLAAQKDLEAKTKELLEREQNNQHLQEKLSASAAEYE
MSKQAYESALDQQKLLLDESQKTITEQRECIDKKLQQIAQLEIKVSDLTYEIKTLIQLAE
IENQSMPIYSSLPLESASSIYPPLSDIFEEEISCLPEKKVRNSMQANIQLKRCIDIAQKI
TGASHYYNTSSRFKDLAVDNYTLDLRRLFDSLRAENASAIIFYSQKENKILFVNNQSRSL
LGWSPDKFVQSFNEIVEPSKDIWRQGIASLAIKNDNHISLKMKSKAGAQVEVHALLGIIP
TGIFRYHVLGILYSSLS

BLAST