GenomeNet

>tr:A0A0H4L2M7_9BACI [A0A0H4L2M7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AKO94983.1};
MENIVIYERLKEINEELYDPFPYEETKSIKKDFKECLTSEACFNADLNTYMMNIVGSVNY
VLRGKGTKIPERQMNALSLTFFEAFPQYSFLENKMNQYPLFYREYARNEEARILILRYVE
NEGVLSQ

BLAST