GenomeNet

>tr:A0A0K1Z050_SARS [A0A0K1Z050] RecName: Full=Accessory protein 7b {ECO:0000256|ARBA:ARBA00030061};
MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV

BLAST