GenomeNet

>tr:A0A0L7LW62_PLAF4 [A0A0L7LW62] RecName: Full=S-antigen protein {ECO:0000256|ARBA:ARBA00015853};
MNRILSVSFYLFFLYLYIYKTYGKVKNTDQEISNIYGTNYYLRNGFLNGKNGKGNKYEDL
QEEGEGENDDEEHSNSEESDNDEENEIIVGQDGSDQEVKVQKEQEDQEVKVQKEQEDQEV
KVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKE
QEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQEVKVQKEQEDQE
VKVQKEQEDQEVKVQKEQEDQEVKVQKEQGPKGTGGPGSEAGTEGPKGTGGPGSEAGTEG
PKGTGGPGSGGEHSHNKKKSKKSIMNMLIGV

BLAST