GenomeNet

>tr:A0A0M3ZK27_9POXV [A0A0M3ZK27] SubName: Full=Putative membrane protein {ECO:0000313|EMBL:ALA62469.2};
MDKNITLSPVFIEPSFKHSFLKSSNKYFYILIFEIIVTLIIINFFFKEEILNAFIPVPVP
KNAITNLLNKTTLSCEENGTMMIHRESGKYPALNLDGSPIIIDDCSLVLSSLNGRSTSPY
AIFNR

BLAST