GenomeNet

>tr:A0A0M4GAX0_9BACI [A0A0M4GAX0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ALC89150.1};
MNNELGNPFPYSDIYKVLEDFKNEFLSLSEDEDFLIGDFNTYCMNIAGTLSYVLGGKINK
IPQGQIEMLKESFFDFYKQYKFLEEKVENYNEFFQEYKNFERARRLLLTLFSN

BLAST