GenomeNet

>tr:A0A0U1P3L7_9BACI [A0A0U1P3L7] SubName: Full=Group-specific protein {ECO:0000313|EMBL:CRK84857.1};
MDNIIKQLTDIKNKLDKPFPYKDTDRIQVDFRVEFLNLSEEEDCLTGDFNTYCMNIAGTL
SYVLSGKTDKITKRQIEIFQMSFFDFFNQYKFFEEKINNYLDFYEEYKNFEETRKLLLQV
VK

BLAST