GenomeNet

>tr:A0A0U1WJY3_SARS [A0A0U1WJY3] RecName: Full=Accessory protein 7b {ECO:0000256|ARBA:ARBA00030061};
MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV

BLAST