GenomeNet

>tr:A0A0U5JAE2_9BACT [A0A0U5JAE2] SubName: Full=Conserved putative membrane protein {ECO:0000313|EMBL:CUI15818.1};
MNQVNEIVSSNMKFKTNNRQYLSIAIIFFYLLPLLFFASYSIGLMSHHKSWSMLSFGLLL
IACGSLCLILLIYYWELALKEKLQTEQSKLFHQISFNPEKENKVTSLDTSHTFPQLIDSE
PHSIKDDIKDLSLLETNLKESQSEQMRLEEEVQSKSLAIEHLTEENQLLSVKAQQTSQDF
SDYKLFSEEQLKQKQLQINLLQQMIEDQRGEMEKRQDQIYQLDTKVHDLSYEIKTLLYLH
ETESAPAKKEDTFKTKISGPFLEDLDNYPMHTNFIPSNNHSNSDKWVRSIPEATILLKKC
ITMAQKLTGANYYSNEATRYREFSSSNYAIDQRRLFDGLRNEEGGLIVVYSQKEHKLLFA
NHQSKALLGWSPDKFTSDFSSIIQEGLADWKRGLNTLSSATESQIRLLAKNKNGQEILLS
CHLGIVPSGLFRNYIIGVLYPT

BLAST