GenomeNet

>tr:A0A133ULM3_9EURY [A0A133ULM3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KXA95081.1};
MDYLLLIIGVLTVYASLMVVFTGERRRRLPYLNAMNFGITALIALSIQHPLTGAVALLYF
IFSTLESNSIASTIDRMREE

BLAST