GenomeNet

>tr:A0A162FG65_9EURY [A0A162FG65] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KZX12585.1};
MIEEIIGVIIIIMAIRTFITNDRMEKVLYINVIDFALSALIAIYINTPFAFVVAATFFIT
STISSNAIAYVFNRLKDEKVLNE

BLAST