GenomeNet

>tr:A0A166EFJ8_9EURY [A0A166EFJ8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KZX16594.1};
MIEEIICIIVIIMAVRAFVTRDRAERMLYINVIDFSVSALIALYINTPFGLIIAIVFFIS
STIGSNAIAYTLNRLDDEIILDE

BLAST