GenomeNet

>tr:A0A166EWZ0_9EURY [A0A166EWZ0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KZX17103.1};
MIEEIIGVIIILMAIRVLITNNRAEKMLYVNVIDFALSALIAIYINTPFGLIVAITFFVT
STISSNAIAYSLNRLKNEVILS

BLAST