GenomeNet

>tr:A0A1B1MRH5_9POXV [A0A1B1MRH5] SubName: Full=Entry/fusion imv membrane protein {ECO:0000313|EMBL:ANS71153.1};
MSTTVNLSPVFVAPTFEHSLLRADKYIFIELFEFIVVVFLVYVFFKDEIVSMFTPVTPIN
ELDKYKDTYLTCYGNKLYIISDNKQLPALSLNFKQIEFEGCSTILRNINGSRTVRISDVL
NRQ

BLAST