GenomeNet

>tr:A0A1C5C7P1_9ACTN [A0A1C5C7P1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:SCF66685.1};
MTTEPATGSSSGWDQAIYRCGRCGAQSTVTTEEAYLQAVGVHTDAHAVWDRLNPMERDGF
ASILRTILSAPDLGFEFLALADRRQHTGDTQSSPAVLGTNTPQPDSSPSNATARATE

BLAST