GenomeNet

>tr:A0A1D2W5X2_9EURY [A0A1D2W5X2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OEC85148.1};
MLIEIAGIIIVFMALRTLIARDRSERMLYLNAMSFGISALIALYIQTPFGAIIAITYFVA
STISSNAIAYSIGRIQEEITVK

BLAST