GenomeNet

>tr:A0A1D3L1W2_9EURY [A0A1D3L1W2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:SCG85558.1};
MLMEILGIIIVVMALRTLFARDRSERMLYLNVIGFALSAMIALYIQTPFGAIMAITFFIT
STLSSNAIAYSIGRVKEEIIKE

BLAST