GenomeNet

>tr:A0A1G7F744_9BACT [A0A1G7F744] RecName: Full=Hfx_Cass5 domain-containing protein {ECO:0000259|Pfam:PF18287};
MVQHIPNTTVDRIEAIGIDANGSLWVKPATKTFPMMYREGMEVHWDASRQCLYSPLPREW
SYLQWFCQINRAAAEQGVALVVDSQTQWNNLDQHLRDEIVRTVNKADLSG

BLAST