GenomeNet

>tr:A0A1G8B450_9BACI [A0A1G8B450] RecName: Full=UPF0242 domain-containing protein {ECO:0000259|Pfam:PF06785};
MALFYLGCAAVLAALLYLFYHVCRKWITKETNMSKKVFAFLSAGGLVIMIAGFEFIDSTT
TATPLHNTDQTTEPLTEELHTLKAENDSLKKDLKTFRTEKQTLEEALQESKKELQELSKK
AEEYMEETTRLIDEMEVLHERIKELEDENASLKAEIDDTEYNENSYNMGATDTTFPSSSQ
QHN

BLAST