GenomeNet

>tr:A0A1L3KNT6_9VIRU [A0A1L3KNT6] RecName: Full=Protein P7 {ECO:0000256|ARBA:ARBA00016841};
MGDTANKLGLGFAPPKRQFSLKNIVQASANAANVISSSKPIKTQPLGVGSPLVVTAPPPL
ICPSKPTNTIAKDIASHVPTQLESIPLNVQSSNTDLLKSKMHQRLRIISFQCVSSNAIRQ
IDGQHGVRKVIFAHQVLQCGCNQIPSHNVKIRQLFDDSKSTPNKTHVTIKKIKEYDAETV
LNEIIQYCDQHSHHEKHFTPKSPTIMISGQLKYNDHNLLRRRFALVTLIGNRPQDVVRLN
EYIARYNLESYASSILETKPGECLIVDQSETYHIFAQCMQSADELPQLSIIQQCLTSASY
ELLHLPCKAIIIPTICQLYGLNHFTQVNDILMRMIDQTFDYHTIPVVCTLDGPNAHLSSH
QHDAYSCVPSLYAHKWFERHEHKLIASLDIICNHLITGTSPNPNVTKPPLPTKPKAIKQD
VKPKSDVHPDLDHITTYTSQQPIPPPTDTPVVNKDSPEKVMSESEQNYLFRRWNTLHETN
YNYIYPNNDYKEVLCIILPPGTGKSSILANQPLLIEADEAFTKQDFVDLNTKNDGLVYSR
IVQRCIKEGCYDNKIVMVHSRQHAQLVGMTIIGSFSICANDLTNSDRFQPYMLACAHEAT
LNMLHCEFETYATFAIWFIDVVRPITDVNLLSNVIWEKCHTVSENLDKFRCANASNQQKL
DWERLYHKFNAHVGYDRDEGSTAPVTTAEVHPPPPPNDEVDSVNERQPIPADSKSDDPIA
SETDAPILTSPATVHSDVSDLPITNENHSSIDLLSENQRLLDEIKELREMNANLSKTISE
QKDAIASRDKLVRELTAQIWELTGTNNKHVAENNILRNSLRDCCSNVDDLKRELCTLNEQ
CQSNIQTSHAELSPIAMQQAQQTPPPAMPPIAEEQSEDILARCLYSEIIQPHIADPTDHD
AVDRFKERLRQCLTKSAITKPKRAMTQTISTEATDGVMRRSFSVSCTHEHPKSADSGICS
NDLRDTALFRISGLCRRLDQFSTQELSYFSMHLNYVQNLLLTIEKLLPEKAYMLPVYSPF
FDSFLPTLGNYWSGSFKRVLYTDSPLSTLCDGLY

BLAST