GenomeNet

>tr:A0A1T5GBH3_9FLAO [A0A1T5GBH3] SubName: Full=Methyl-accepting chemotaxis protein (MCP) signalling domain-containing protein {ECO:0000313|EMBL:SKC05671.1};
MKLTDENQEKLSALENIANGIMWWIGSIPSLVVHTIFFILCFALPIIGLVDWDHMLLVLT
TLLSLEAIYLAIFIQMSVNKSSEHIEVLREDVEEIQEDIDEIQEDIEEISEDIEEISEDI
EDISEDIEEINEDIDEIQEDIEEINEDEEDEDHGERARTVMLKSKVSSNRYEIKQLRDKI
SELESLIDRIKEKEKEEGE

BLAST