GenomeNet

>tr:A0A1V6N3K0_METAZ [A0A1V6N3K0] SubName: Full=Energy-converting hydrogenase A, subunit C {ECO:0000313|EMBL:OQD59241.1};
MIEEIIGIIIIIMAIRTILAKNKAERMLYVNVIDFAVSALIALTVDSPFGLIIAITFFIT
STIGSNAIAYTLNRLENEIILDE

BLAST