GenomeNet

>tr:A0A2C9DSM6_9POXV [A0A2C9DSM6] SubName: Full=Entry and fusion IMV protein {ECO:0000313|EMBL:ATI21009.1};
MSRSITFRPVFIEPKFEHRFLTGSFRYGYLVLFELAVAALLIRWFLGAEARETFAKLRRR
RPRVDAIAALTSGASLRCTGPKLMLTTRSDAVPVPALNYDGSPVEIDDCSSLLRSVNGP

BLAST