GenomeNet

>tr:A0A2I6BQT2_9POXV [A0A2I6BQT2] SubName: Full=Membrane protein {ECO:0000313|EMBL:AUI80634.1};
MEKKHSNIYFTPVFVEPTIKHSLLNAYKYTYIVLFEVLFVAFLLYLFFRSEIMMLLNYKN
DMVKDPLEKFLKTSLSCNGDKLIINKLPNSSSNVNALAINRTPITNKNCKALLQSINGSQ
QVSLNDILRR

BLAST