GenomeNet

>tr:A0A2I7SS90_LACSH [A0A2I7SS90] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AUS08775.1};
MHAIVRLYIFIKLKYRCFIERRSKLRILAGILACFILAGCAHEESKQPKLSPVTIRVLDQ
EGKPVSRIAVGIEAVIPEEERDSVGAIPKAGLTNENGEIKDQLVPGKKYIIQLGSKKKEV
VITDKPMIVELTK

BLAST