GenomeNet

>tr:A0A2K5XH08_MANLE [A0A2K5XH08] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSMLEP00000002595};
EGGREKVTRKEGWKRGHEDSYLEMAQRHLQRSLYPWVLYLPQPYAEHSKVILNGTLHCHF
KRISQIFAGHFMEGDTEVTMLSCILIER

BLAST