GenomeNet

>tr:A0A2R7LA06_9CAUL [A0A2R7LA06] RecName: Full=Hfx_Cass5 domain-containing protein {ECO:0000259|Pfam:PF18287};
MRTDSIKEIGIDAEGRLYIEPRSSTFPFVYLEAMQVGWDSDLRRLFSPKPTEWSYVDWFR
QLTEAAVLQGVRLRLSGSTRWRNIDPSVRQQIKAEERGSRPAGWYVACCAGGLASGFLAG
LLALLVSGHLYEMGLPDPLTIWVSLPVIPTLAYVPLYLRARWFKPLPRIVGSIAFLAFAT
AGLFALLVLVARADAGI

BLAST