GenomeNet

>tr:A0A2U1S9H2_9EURY [A0A2U1S9H2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PWB87136.1};
MYVEIIGVITIFVALRALITRNRAEKLLYLNVIGFTVPALIALVIDTPFALIVAAVFFVC
STISSNAIAYSLKRLDDEVILD

BLAST