GenomeNet

>tr:A0A2U9IE15_9CREN [A0A2U9IE15] SubName: Full=Sulfur oxidation protein {ECO:0000313|EMBL:AWR94255.1};
MPKPYIAINMADLKNEPKTFEMFSAVGPKVCMVTARHPGFVGFQNHVQIGVLPFGERFGG
AKMDMTKESSTVRVLQYTMWKDWKDHEEMHRQNWSYLFRLCYSCASQMVWGPWEPIYEIK
YADMPINTEMTDFTAVVGKKFAEGKPLEIPVISQPYGKRVVAFGEHTVIPGKEKQFEDAI
IKTLEMFKRAPGFLGAMLLKEIGVSGIGSFQFGSKGFHQLLESPGSLEPDPNNVMYQVPE
AKPTPPQYIVHVEWANLDALQFGMGRVLLSPEYREVHDEALDTLIYGPYIRIINPVMEGT
FWREYLNE

BLAST