GenomeNet

>tr:A0A328P999_9EURY [A0A328P999] SubName: Full=DUF2109 domain-containing protein {ECO:0000313|EMBL:RAO79107.1};
MIEETIISCIIIYMVLRLFITQNRLERMPYLNVINFGVAAVITLKNPSPLGAITSMVYFI
LATVGANAIAFTISKVKEIEQ

BLAST