GenomeNet

>tr:A0A366ME94_9EURY [A0A366ME94] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:RBQ23809.1};
MIEEIIGLIIIILAIRTLVAKNKAERMLYVNTIDFAVSALIALFIDSPFGLIVAITFFIT
STVSSNAIAYTLNRLDNEIILDED

BLAST