GenomeNet

>tr:A0A369QAG6_9BACT [A0A369QAG6] RecName: Full=Hfx_Cass5 domain-containing protein {ECO:0000259|Pfam:PF18287};
MESDNIQEIGINQNGQLFIKPDKRKFPLIYRTATEVHWDSNKNILYSPKPREWTYLDWFR
HIITTLETECDCKLQITPETIWVSIPETLNAEIRNDKK

BLAST