GenomeNet

>tr:A0A3F2YKM0_SHEVT [A0A3F2YKM0] SubName: Full=Uncharacterized protein {ECO:0000313|RefSeq:NP_659636.1};
MEKNNSKNIYFTPVFIEPTIKHSLLQSYKYTYIIIFEIITVMVLLFLFFKSEIKMLFNFK
QQKVISPIDKFSKTTLYCKENKLFISGLPNTMYSKEALSLNRQPITYKYCNDLLQSINGS
QQVSINDILRKR

BLAST