GenomeNet

>tr:A0A3N1IYN6_9ENTR [A0A3N1IYN6] SubName: Full=Colicin E1 (Microcin) immunity protein {ECO:0000313|EMBL:ROP59155.1};
MTWGYYFKKMVWGVIPILIVYLDWQVSQDNQKLTYMLIFSVISGILYPFANKIMERFGML
FAKKEFWKKDFFTSATGGSLQAILFIFCFVFAIPLTLGFSVYALVKHLAKIG

BLAST