GenomeNet

>tr:A0A483CSB7_9EURY [A0A483CSB7] SubName: Full=DUF2109 domain-containing protein {ECO:0000313|EMBL:TAJ44091.1};
MAELIALYVCGAIALLAAVRTIIEPDTYRKLPYLNVMNFAIAGLIVLILSHPLSILAAAA
YFVGSTLEANAIASARAEVMQHD

BLAST