GenomeNet

>tr:A0A498GYQ6_9EURY [A0A498GYQ6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:RXE55553.1};
MIALPLLGAIAVFAALRAVFERKTGRKLPYLNAMNFAIAGSLVLLLDHPLALVAAAAYFV
GSTLESNAIASTYAGGILKDE

BLAST