GenomeNet

>tr:A0A5C8L8G5_9BACL [A0A5C8L8G5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:TXK73851.1};
MRKLNGYEDLRNLQRDFALEFKKNAPHEIITADLNTYLMFISGLASGGLQSQLEDALERF
NMKKWLEKSFYDWFPKYRFLETWDLTHYSALNADLTFFNQARSMMLEVIREVESNRTRN

BLAST